PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G02065.2
Common NameSPL8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 246aa    MW: 27504.1 Da    PI: 7.3421
Description squamosa promoter binding protein-like 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G02065.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP80.91.8e-25187236150
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                  +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrf 
  AT1G02065.2 187 RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFV 236
                  6************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-26182236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.854185246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-23186236IPR004333Transcription factor, SBP-box
PfamPF031104.7E-19188237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0030154Biological Processcell differentiation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009046anatomyflower
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MLDYEWDNPS SIVLSGDERN PDSDPTRSSF SFFDPISHYN NDHRHITISP PLLSSFSNQQ  60
QQHHLTLYGQ TNSNNQFLHH HHHHHSLYGS TTTTTPYGAS DPIYHPHSSA PPASLFSYDQ  120
TGPGSGSGSS YNFLIPKTEV DFTSNRIGLN LGGRTYFSAA DDDFVSRLYR RSRPGESGMA  180
NSLSTPRCQA EGCNADLSHA KHYHRRHKVC EFHSKASTVV AAGLSQRFCQ QCSRFVPPKV  240
ATFDLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-19188235653squamosa promoter-binding protein-like 12
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.4990.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G02065
AtGenExpressAT1G02065
Functional Description ? help Back to Top
Source Description
TAIREncodes an SBP-box gene, a member of the SPL gene family. Mutants are affected in micro- and megasporogenesis, trichome formation on sepals, and stamen filament elongation.
Function -- GeneRIF ? help Back to Top
  1. Data demonstrate that miR156 is a quantitative, rather than spatial, modulator of SPL8 expression in leaf primordia and that SPL6 activity nonautonomously inhibits initiation of new leaves at the shoot apical meristem.
    [PMID: 18492871]
  2. SPL8 and miR156-targeted SPL genes control gynoecium patterning through interference with auxin homeostasis and signalling.
    [PMID: 23621152]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEX26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G02065.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G69120
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G02065
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116410.0AJ011641.1 Arabidopsis thaliana (ecotype Columbia) spl8 gene, exons 1-3.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankU899590.0U89959.1 Arabidopsis thaliana BAC T7I23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_973738.10.0squamosa promoter binding protein-like 8
SwissprotQ8GXL31e-177SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLQ3EDL20.0Q3EDL2_ARATH; Squamosa promoter-binding-like protein 8
STRINGAT1G02065.11e-174(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Unte US, et al.
    SPL8, an SBP-box gene that affects pollen sac development in Arabidopsis.
    Plant Cell, 2003. 15(4): p. 1009-19
    [PMID:12671094]
  2. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  3. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  4. Birkenbihl RP,Jach G,Saedler H,Huijser P
    Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains.
    J. Mol. Biol., 2005. 352(3): p. 585-96
    [PMID:16095614]
  5. Zhang Y,Schwarz S,Saedler H,Huijser P
    SPL8, a local regulator in a subset of gibberellin-mediated developmental processes in Arabidopsis.
    Plant Mol. Biol., 2007. 63(3): p. 429-39
    [PMID:17093870]
  6. Xing S,Zachgo S
    ROXY1 and ROXY2, two Arabidopsis glutaredoxin genes, are required for anther development.
    Plant J., 2008. 53(5): p. 790-801
    [PMID:18036205]
  7. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  8. Xing S,Salinas M,H
    miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis.
    Plant Cell, 2010. 22(12): p. 3935-50
    [PMID:21177480]
  9. Smaczniak C, et al.
    Characterization of MADS-domain transcription factor complexes in Arabidopsis flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1560-5
    [PMID:22238427]
  10. Xing S, et al.
    SPL8 and miR156-targeted SPL genes redundantly regulate Arabidopsis gynoecium differential patterning.
    Plant J., 2013. 75(4): p. 566-77
    [PMID:23621152]
  11. Debernardi JM, et al.
    Post-transcriptional control of GRF transcription factors by microRNA miR396 and GIF co-activator affects leaf size and longevity.
    Plant J., 2014. 79(3): p. 413-26
    [PMID:24888433]